Protein Info for BWI76_RS05085 in Klebsiella michiganensis M5al

Annotation: general secretion pathway protein GspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR02533: type II secretion system protein E" amino acids 11 to 489 (479 residues), 687 bits, see alignment E=6.9e-211 PF22341: GSPE_N1E" amino acids 11 to 72 (62 residues), 58.1 bits, see alignment E=7.9e-20 PF00437: T2SSE" amino acids 108 to 487 (380 residues), 539 bits, see alignment E=4.7e-166

Best Hits

Swiss-Prot: 100% identical to GSPE_KLEPN: Type II secretion system protein E (pulE) from Klebsiella pneumoniae

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 87% identity to kpu:KP1_0989)

MetaCyc: 59% identical to type II secretion system protein GspE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYZ6 at UniProt or InterPro

Protein Sequence (497 amino acids)

>BWI76_RS05085 general secretion pathway protein GspE (Klebsiella michiganensis M5al)
MTPAAERRPLLPFGYARAHSVMLLSSGESCEVFCLAVTAPQALLEARRVAAMPFRLERLE
EEAFEKLLVLSYQRDSAEARRMMADIGNELDLYTLAEELPDTDDLLDSEDDAPIIRLINA
MLTEAIKEKASDIHIETYERHLQIRFRVDGVLREILRPQRRLAALLISRIKVMASLDIAE
KRIPQDGRMALRIGGRAVDVRVSTLPSSYGERVVLRLLDKNSVNLDLLTLGMTPALLRQV
DGLIARPHGIVLVTGPTGSGKSTTLYAALSRLDARERNIMTIEDPIEYELEGIGQTQVNA
KVDMTFARGLRAILRQDPDVVLVGEIRDGETAQIAVQASLTGHLVLSTLHTNSALGAISR
LQDMGVEPFLLSTSLLAVMSQRLVRRLCPHCRQQEPANADTAHQMEIAPGTALWQPRGCA
ECGFTGYRGRTGIHELLLVDDRVRMAIHRGENEVTLIQQLGTDYMTLRRAGREKALAGIT
SWQEVLRVTEQPIAEAC