Protein Info for BWI76_RS05075 in Klebsiella michiganensis M5al

Annotation: type II secretion system protein GspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 26 (26 residues), 37.5 bits, see alignment 1.1e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 26 (23 residues), 34.9 bits, see alignment 8.8e-13 TIGR01710: type II secretion system protein G" amino acids 5 to 135 (131 residues), 188 bits, see alignment E=7.2e-60 PF08334: T2SSG" amino acids 29 to 135 (107 residues), 125.6 bits, see alignment E=9e-41

Best Hits

Swiss-Prot: 100% identical to GSPG_KLEPN: Type II secretion system protein G (pulG) from Klebsiella pneumoniae

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 90% identity to kpe:KPK_4579)

MetaCyc: 70% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYQ0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>BWI76_RS05075 type II secretion system protein GspG (Klebsiella michiganensis M5al)
MQRQRGFTLLEIMVVIVILGVLASLVVPNLMGNKEKADRQKVVSDLVALEGALDMYKLDN
SRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSL
GPDGVPESNDDIGNWTIGKK