Protein Info for BWI76_RS05050 in Klebsiella michiganensis M5al

Annotation: general secretion pathway protein GspL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 246 to 262 (17 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 14 to 394 (381 residues), 239.2 bits, see alignment E=4.1e-75 PF05134: T2SSL" amino acids 31 to 236 (206 residues), 174.9 bits, see alignment E=1.8e-55 PF12693: GspL_C" amino acids 243 to 394 (152 residues), 113.4 bits, see alignment E=9.7e-37

Best Hits

Swiss-Prot: 100% identical to GSPL_KLEPN: Type II secretion system protein L (pulL) from Klebsiella pneumoniae

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 55% identity to kpe:KPK_4584)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU9 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BWI76_RS05050 general secretion pathway protein GspL (Klebsiella michiganensis M5al)
MNNHHTSSAAVLIIRLNPDAATAIWRLAAPGDTAQTGEWHPDAGDPTLSLLAQRHPAWVL
VPASDCAFHRVALPAGARRRPQQALAFLLEEQLATEVEESHFALLHQHKTDCAVAVVGRG
KMRAWQAWCDSLGLSVLALTPDVLALPHSPTGWSAVRCGEQWLFRCDTWGGMAVETVWLD
QLLTHWQDLAPIACYSPPPDIAAPWQPLPAQDLLQLAAANPDARRICLRQGDFAAKRRRQ
PTPRRWRPVIVAALALLLLWSSNCLHDHLMLGQQADAAVQASRDFYRQWFQTEKNVVNPR
LQMQQHLRQMKNAGARPALISRLGALQQIIDDTPGIRLRTLSFDAARNALQLEISAVSSQ
ALEQFSQRARARFRVQTGEMKPRADGIEGRLTLEGNDA