Protein Info for BWI76_RS05020 in Klebsiella michiganensis M5al

Annotation: sugar fermentation stimulation protein SfsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR00230: sugar fermentation stimulation protein" amino acids 4 to 233 (230 residues), 300.4 bits, see alignment E=3.7e-94 PF17746: SfsA_N" amino acids 13 to 80 (68 residues), 78.1 bits, see alignment E=4.4e-26 PF03749: SfsA" amino acids 84 to 222 (139 residues), 172.7 bits, see alignment E=3.9e-55

Best Hits

Swiss-Prot: 87% identical to SFSA_KLEP7: Sugar fermentation stimulation protein homolog (sfsA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_11520)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYQ6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>BWI76_RS05020 sugar fermentation stimulation protein SfsA (Klebsiella michiganensis M5al)
MLFTPPLRSATLIKRYKRFLADVITPDGRELTLHCPNTGAMTGCAAPGDTVWYSTSDNPK
RKYAHTWEITETVEGATICVNTLRANTLAKEAILAGNIPELLGYNTLKSEVKYGDENSRI
DILLQADDQQNCYIEVKSVTLAEKEYGYFPDAVTERGQKHLRELMSVAAAGDRAVILFAV
LHSAIDRFSPAHHIDARYAQLLIEAQNKGVEILAYKAELSTEMMTLNKPITVVLTPGK