Protein Info for BWI76_RS05010 in Klebsiella michiganensis M5al

Annotation: tRNA glutamyl-Q synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 6 to 270 (265 residues), 366.2 bits, see alignment E=5.3e-114 PF00749: tRNA-synt_1c" amino acids 9 to 237 (229 residues), 144.8 bits, see alignment E=1.5e-46

Best Hits

Swiss-Prot: 86% identical to GLUQ_KLEP3: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_11510)

MetaCyc: 76% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.M62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYV5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BWI76_RS05010 tRNA glutamyl-Q synthetase (Klebsiella michiganensis M5al)
MKDSHYIGRFAPSPSGELHFGSLIAALGSYLQARAQNGIWRVRIEDIDPPREVPGAADTI
LRQLERYGLHWDGEVLWQSKRHEAYREHLAWLREQDLCYYCTCTRARIHGIGGIYDGHCR
DLRLGAENAALRLRQTRPVLEFYDRLRGTIVADEPLAREDFIIHRRDGLFAYNLAVVVDD
HFQGVSEIVRGADLIEPTVRQISLYQHFGWQAPDYIHLPLALNAQGNKLSKQNHAPALSE
GDPRPEIVRALTFLNQDVIQEWQTLSIEDLLEYAIANWRPEQIQHSQMRSAEL