Protein Info for BWI76_RS04995 in Klebsiella michiganensis M5al

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 1 to 263 (263 residues), 411.4 bits, see alignment E=8.7e-128 PF02548: Pantoate_transf" amino acids 4 to 257 (254 residues), 344.2 bits, see alignment E=2.5e-107

Best Hits

Swiss-Prot: 95% identical to PANB_CITK8: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 92% identity to cro:ROD_01451)

MetaCyc: 90% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYP2 at UniProt or InterPro

Protein Sequence (263 amino acids)

>BWI76_RS04995 3-methyl-2-oxobutanoate hydroxymethyltransferase (Klebsiella michiganensis M5al)
MKPTTIALLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTVQGHDSTLPV
TVEDIAYHTRAVRRGAPNCLLLADLPFMAYATPEQTFENAAIVMRAGANMVKIEGGAWLA
DTVKMLAERAVPVCGHLGLTPQSVNVFGGYKIQGRGDAGQVLLDDALALEAAGAQLLVLE
CVPVELAKRVTEALTIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLSTAGDMR
AAVRQYVAEVESGVYPGEEHSFH