Protein Info for BWI76_RS04960 in Klebsiella michiganensis M5al

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 38 to 187 (150 residues), 181.1 bits, E=9.3e-58

Best Hits

Swiss-Prot: 96% identical to CAN_SHIFL: Carbonic anhydrase 2 (can) from Shigella flexneri

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 96% identity to kpu:KP1_0961)

MetaCyc: 96% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See A0A285AYU6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>BWI76_RS04960 carbonate dehydratase (Klebsiella michiganensis M5al)
MNDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGEL
FVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAIENTELGLIDNWL
LHIRDIWFKHSSLLGEMPEERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWA
YGIHDGMLRDLDVTAVSRETLEQRYRHGISNLKSKHVNHK