Protein Info for BWI76_RS04925 in Klebsiella michiganensis M5al

Annotation: spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF17284: Spermine_synt_N" amino acids 6 to 57 (52 residues), 72.8 bits, see alignment 2.6e-24 TIGR00417: spermidine synthase" amino acids 7 to 278 (272 residues), 404.4 bits, see alignment E=1e-125 PF01564: Spermine_synth" amino acids 60 to 239 (180 residues), 237.9 bits, see alignment E=9.3e-75

Best Hits

Swiss-Prot: 93% identical to SPEE_KLEP7: Polyamine aminopropyltransferase (speE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 90% identity to ecx:EcHS_A0125)

MetaCyc: 90% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYL9 at UniProt or InterPro

Protein Sequence (287 amino acids)

>BWI76_RS04925 spermidine synthase (Klebsiella michiganensis M5al)
MADSNLWHETLHDHFGQYFSVDNVLYHEKTEHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLMAHGQAKHVLIIGGGDGAMLREVSRHGNVESITMVEIDAGVVSFCRQY
LPNHNAGAYDDPRFTLVIDDGVNFVNQTAQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVSFLQQDEAVDSHRKLSHYFSDVSFYQAAIPTYYGGIMTFAWATDNE
ALRHLSSEIIQARFHKSNLKCRYYNPAIHAAAFALPQYLLNALSTVK