Protein Info for BWI76_RS04905 in Klebsiella michiganensis M5al

Annotation: DUF3300 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11737: DUF3300" amino acids 60 to 332 (273 residues), 277.8 bits, see alignment E=3.4e-87

Best Hits

KEGG orthology group: None (inferred from 67% identity to stm:STM0157)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYS7 at UniProt or InterPro

Protein Sequence (528 amino acids)

>BWI76_RS04905 DUF3300 domain-containing protein (Klebsiella michiganensis M5al)
MTLPFKPHLLALLCSAGLLAAAGTLYVKSREPQTAPEPPAVAQTAQTTAAAQPVTATYTP
AQIDQWVAPIALYPDNLLSQVLMAATYPSNVVQAVQWSQDNPAMKGDAAVQAVASQPWDP
SVKSLVAFPSLLALMGENPPWIENLGNAFLAQPQDVMDSVQRLRAIAQQTGTLKSTPQQK
VITATNAAATSTTSTSRSSSAVTSSPPAQVIKIESADPNVVYVPAYNPSVVYGAWPNTAY
PPVYLPPPPGEQFTDSFVKGFGYSLGVATTYALFSSIDWDDDDRHHDDDDHHHDDDHHGG
YSHNGDNININVNNFNHITGQNLPGNHANWQHNPAWRGNIPYPNNNIAQHYHQTNVPGGL
SATQHQPVDRNAQRQAAMTQLQQRTGPAAAADNSLARAPSRDAQRQLASQQLHQVTQRNN
YRGYDATPAVTHNAVQQQHREAVKSQIQHPTAQQQQRREQLRTATPAQRQQKLNDLHANA
LSGNDIRSPSWQSQQARGLQSRHISGLSSEQRSAAREQLSEHHELRRR