Protein Info for BWI76_RS04850 in Klebsiella michiganensis M5al

Annotation: N-acetylmuramoyl-L-alanine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF01510: Amidase_2" amino acids 26 to 167 (142 residues), 114.2 bits, see alignment E=2.8e-37

Best Hits

Swiss-Prot: 84% identical to AMPD_CITFR: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Citrobacter freundii

KEGG orthology group: K03806, AmpD protein (inferred from 88% identity to kpn:KPN_00112)

MetaCyc: 85% identical to 1,6-anhydro-N-acetylmuramoyl-L-alanine amidase (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYL2 at UniProt or InterPro

Protein Sequence (183 amino acids)

>BWI76_RS04850 N-acetylmuramoyl-L-alanine amidase (Klebsiella michiganensis M5al)
MQLNGGWLVEARRVPSPHQDSRPDNETPSLLVVHNISLPPGEFGGPWIDALFSGTLDPHA
HPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSSYHGRERCNDFSIGIELEGT
DELAYTDAQYQQLAAVTRQLIPLYPAIADNITGHSDIAPVRKTDPGPAFDWVKFRGLLTP
SSE