Protein Info for BWI76_RS04830 in Klebsiella michiganensis M5al

Annotation: type IV pilin biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 167 to 192 (26 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF00482: T2SSF" amino acids 64 to 186 (123 residues), 105.3 bits, see alignment E=1.1e-34 amino acids 268 to 388 (121 residues), 96.3 bits, see alignment E=6.9e-32

Best Hits

Swiss-Prot: 38% identical to PILC_PSEPU: Type 4 fimbrial assembly protein PilC (pilC) from Pseudomonas putida

KEGG orthology group: K02505, protein transport protein HofC (inferred from 71% identity to kpn:KPN_00108)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYL6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BWI76_RS04830 type IV pilin biogenesis protein (Klebsiella michiganensis M5al)
MATKRLWRWRGITLQGAPCQGTLWQDNRPEALQVLQQQRIIPLTLRRCSVQNALWHPRYS
GEIIRQLAALLQAGLPLAEGLELLAQQQPNAQWQALLQTLAEDLAQGISLSGSLEKWPEA
FPPLYLAMIRTGELTGKLELCCAELAQQQREQLLLTEKVKKALRYPLIILTLALLVVMGM
LCFVLPEFAAIYQTFNTPLPWLTRVVMSVGEGLTRFWPLLAALGILPAILNRLICQRPGW
LLYRQKLLHTLPVFGKLLCGQRLSQIFTVLALTQSAGISFLQGLQSVEETLNCPLWRQRL
RQVCRQITHGDPIWQALANSGGFTPLCLQLIRTGEASGSLDTMLANLARHHSEQTHQQAD
NLATLLEPMMLVVTGTIVGVLVVAMYLPIFHLGDAISGMGG