Protein Info for BWI76_RS04820 in Klebsiella michiganensis M5al
Annotation: dephospho-CoA kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to COAE_SALTY: Dephospho-CoA kinase (coaE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 84% identity to eae:EAE_11320)MetaCyc: 74% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]
Predicted SEED Role
"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)
MetaCyc Pathways
- superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
- superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
- coenzyme A biosynthesis I (bacteria) (4/4 steps found)
- coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AYR8 at UniProt or InterPro
Protein Sequence (206 amino acids)
>BWI76_RS04820 dephospho-CoA kinase (Klebsiella michiganensis M5al) MTYTVALTGGIGSGKSTVADAFSHLGVNVIDADIIARQVVEPGTPGLNAIAQRFGPQILN EDGTLNRRALREHIFAHAEDKSWLNALLHPQIQQETRRQMQLATSSYILWVVPLLVENRL SAKADRVLVVDVPKETQIERTMLRDRVSRQHAEHILAAQATREQRLAVADDVIENMGSPD AIASDVARLHAKYQRLASQAASQEKP