Protein Info for BWI76_RS04765 in Klebsiella michiganensis M5al

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 21 to 475 (455 residues), 606.7 bits, E=1.5e-186
• PF01225: Mur_ligase
  • amino acids 21 to 119 (99 residues), 117.4 bits, E=4.3e-38
• PF08245: Mur_ligase_M
  • amino acids 124 to 304 (181 residues), 101.5 bits, E=9.3e-33
• PF02875: Mur_ligase_C
  • amino acids 339 to 415 (77 residues), 50.9 bits, E=2.4e-17

Best Hits

Swiss-Prot: 97% identical to MURC_KLEP3: UDP-N-acetylmuramate--L-alanine ligase (murC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_11265)

MetaCyc: 93% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See A0A285AYP7 at UniProt or InterPro

Protein Sequence (491 amino acids)

>BWI76_RS04765 UDP-N-acetylmuramate--L-alanine ligase (Klebsiella michiganensis M5al)
MNTQDLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
AQLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQITTYGFSDDADVRVEEYRQVGAQGHFRLVRQDKDVIQVTLNAPGRHNALNAAAA
VAVATEEGIDDEAILRALESFQGTGRRFDFLGEYPLAEVNGKSGTAMLIDDYGHHPTEVD
ATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLTQVDALLMLDVYSAGEAAIPGA
DSRSLCRTIRGRGKVDPILVSDPAQAAEMLASVLTGNDLVLVQGAGNIGKIARHLAEIKL
QPQTTQEERHG