Protein Info for BWI76_RS04750 in Klebsiella michiganensis M5al

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 7 to 94 (88 residues), 122.6 bits, E=1e-39
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 8 to 435 (428 residues), 428.1 bits, E=2.4e-132
• PF08245: Mur_ligase_M
  • amino acids 110 to 280 (171 residues), 85.7 bits, E=6.3e-28
• PF02875: Mur_ligase_C
  • amino acids 301 to 370 (70 residues), 41.8 bits, E=1.6e-14

Best Hits

Swiss-Prot: 89% identical to MURD_ECOL5: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_11250)

MetaCyc: 89% identical to UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase. [EC: 6.3.2.9]

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See A0A285AYJ3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BWI76_RS04750 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Klebsiella michiganensis M5al)
MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPAGLDKLPEAVERYVGGLNE
DWLLTADLIVASPGIALAHPSLSAAADAGVEIVGDIELFCREAQAPIIAITGSNGKSTVT
SLVGEMAKAAGLNVGVGGNIGLPALMLLDPERELYVLELSSFQLETTSSLRAVAATILNV
TEDHMDRYPLGLQQYRAAKLRVYENARACIVNADDALTMPVRGADDRCISFGVDVGDYHL
NRQQGETWLRVKGEKVLNVKEMKISGQHNYSNALAALALADAAGLPRASSLKALTTFTGL
AHRFQQVLEHNGVRWINDSKATNVGSTEAALNGLHLDGTLYLLLGGDGKSADFTPLSRYL
TGDHVRLYCFGRDGAQLAALRPDVAVQTETMEQAMRQIAPQVVPGDMVLLSPACASLDQF
KNFEQRGDVFARLAKELG