Protein Info for BWI76_RS04650 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 111 (17 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 351 (340 residues), 105.6 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 37% identical to YDIN_ECOLI: Inner membrane transport protein YdiN (ydiN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_11155)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYH1 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BWI76_RS04650 MFS transporter (Klebsiella michiganensis M5al)
MKNPYVPTAAGLYLNYLIHGMGVLLITLNMANLQEQWGTDAAGVSIVISSLGIGKLATIV
TGFLSDRFGRKPFIYLGIASYVVFFLGILLTKNIYLAYCCGIMAGLANSFLDSGTYPALM
ESFPNSASRANVLIKAFVSAGQFLLPFIISLLIWANMWYGWSFIIAAALMLLSAVYLIKM
PFPDHRAKKESAEKSPAAAAAPQADSSKLDMVIFTLYGYIGMATFYLVSQWLAQYGEFVA
GIPHESAIKLLSVYTAGSLTCVFVTAAFVKEVFSSAVAMIVYTFLSMIALLIVCLFPTPM
VVTGFAFIIGFSAAGGVLQIGATIMAMSFPNGKGKATGIFYTAGSLASFTIPLITAKLSK
IGIASIMWFDLLIAIVGFVIALYIGYRQLQVRAAARTSHVAATA