Protein Info for BWI76_RS04645 in Klebsiella michiganensis M5al

Annotation: 3-dehydroquinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR01093: 3-dehydroquinate dehydratase, type I" amino acids 19 to 246 (228 residues), 267.4 bits, see alignment E=7.5e-84 PF01487: DHquinase_I" amino acids 20 to 246 (227 residues), 271.7 bits, see alignment E=3.8e-85

Best Hits

Swiss-Prot: 88% identical to AROD_KLEP7: 3-dehydroquinate dehydratase (aroD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_11150)

MetaCyc: 55% identical to 3-dehydroquinate dehydratase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase I (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYG7 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BWI76_RS04645 3-dehydroquinase (Klebsiella michiganensis M5al)
MTQAVTVKNITFQEGETLICVPLIGKTLAELQTNARALATAGADIIEWRVDHFTQVREIE
QVLLALGEIRQLLDAIPLLFTFRSKKEGGETEISDEAYFELNRQAAVSGLTDVIDIELFN
DEAQIRSLVNDAHAAGVKVIMSNHDFHKTPAQEDIIYRLRRMQDLGADLPKIAVMPQSPQ
DVLTLLSATLTMKEKYATRPLITMSMGKSGGVSRVTGRLFGSAMTFGTVGQASAPGQIAI
TQLRELMDILS