Protein Info for BWI76_RS04635 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 392 (363 residues), 189.8 bits, see alignment E=6.9e-60

Best Hits

KEGG orthology group: None (inferred from 86% identity to eae:EAE_11140)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYK2 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BWI76_RS04635 MFS transporter (Klebsiella michiganensis M5al)
MRTIDAQERPILPSAAQKRTKTRIVILMLLSIGTMINYLDRTILGIVAPKLTSEIHIDPA
MMGIVFSAFAWTYALAQIPGGMFLDRFGNKLTYALAIFFWSTFTLLQSFSVGLKSLLLLR
LGLGISEAPCFPVNSRVVSKWFPQHERARATATYTVGEYIGLAAFSPLLFLILEHHGWRT
LFILTGGLGIAFTFVWWKFYHEPHQSKTANKAELEYIGVENTAAANENIPFNWPDAKRLL
CCRQIIGASLGQFAGNTTLVFFLTWFPTYLANERHLPWLHVGFFASWPFLAAAIGIFFGG
WASDKILKKTQSVNISRKLPIISGLLLSSCIILANWVDSNTAVIIIMSVAFFGQGMVGLG
WTLISDIAPKNMGGLTGGIFNFCANMASIITPLIIGVIISMTGNFFYALIYIGLTAIIGV
IAYIFIIGDIKRIELK