Protein Info for BWI76_RS04620 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator SgrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 PF12793: SgrR_N" amino acids 5 to 118 (114 residues), 144.1 bits, see alignment E=2.2e-46 PF00496: SBP_bac_5" amino acids 164 to 306 (143 residues), 65.2 bits, see alignment E=6.2e-22

Best Hits

Swiss-Prot: 80% identical to SGRR_SALPA: HTH-type transcriptional regulator SgrR (sgrR) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K11925, SgrR family transcriptional regulator (inferred from 91% identity to kpn:KPN_00068)

Predicted SEED Role

"SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA" in subsystem Sugar-phosphate stress regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYF8 at UniProt or InterPro

Protein Sequence (551 amino acids)

>BWI76_RS04620 transcriptional regulator SgrR (Klebsiella michiganensis M5al)
MSSGRLQQQFIRLWQCCDGKSQETTLNELAEMLSCSRRHMRTLLNMMEARGWLTWEAEAG
RGKRSRLAFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKAAVRQMLVSHLGRSFRQGRH
ILRVLYYRPMKNLLPGSALRRSETHIARQIFSALTRVNEENGELEADIAHHWQQITPTHW
RFFLRPGIHFHHGRELEMEDVITSLQRSNALPLFSHIERIDSPTAWTLDIHLSQPDRWLP
WLLSQVPAMILPHEWQSMDNFSSIPVGTGPYSVVRNNQNQLKIHAFDDYFGYRALIDEVN
VWVLPEISEEPNGGLTLQGTTQSEKAVESRLEEGCYYLLFDARSPLGANAAVRQWLSYLF
QPASLLYHAGEHYQGNWFPAYGLLPRWHHARSHACEKPPGLETVRLTYYQDHVEHRVIGG
IMATLLAEHQVKLEIQELEYQEWHRGEAVSDVWLNSANFTLPIDFSLFAWLYEVPLIRNC
IPIDWEEDASRWRAGELNPATWSQQLLANQTVVPLIHHWLMIQGQRSMRGVRMNTLGWFD
FKSAWFAPPEP