Protein Info for BWI76_RS04605 in Klebsiella michiganensis M5al

Annotation: thiamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR01277: thiamine ABC transporter, ATP-binding protein" amino acids 2 to 213 (212 residues), 358.6 bits, see alignment E=5.4e-112 PF00005: ABC_tran" amino acids 18 to 157 (140 residues), 131.3 bits, see alignment E=3.9e-42

Best Hits

Swiss-Prot: 78% identical to THIQ_SHIDS: Thiamine import ATP-binding protein ThiQ (thiQ) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_11110)

MetaCyc: 78% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYL0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>BWI76_RS04605 thiamine ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MLKLNDVTWLYQHLPMRFTLAVERGERIAVLGPSGAGKSTLLNLIAGFLPPASGSIDIDG
QPHTHTPPARRPVSMLFQENNLFNHLTIRQNIALGMHPGLKLNAEQTAHLRAIAEQMGID
AMLERLPGELSGGQRQRAALARCLVRKQPVLLLDEPFSALDPALRQEMLALVADVCQQQR
LTLLMVSHSVEDAARIAPRSIVVAEGRIAWDGDTASLLSGNSSASALLGISAK