Protein Info for BWI76_RS04560 in Klebsiella michiganensis M5al

Annotation: holo-ACP synthase CitX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03124: holo-ACP synthase CitX
  • amino acids 11 to 174 (164 residues), 201.3 bits, E=5e-64
• PF03802: CitX
  • amino acids 11 to 174 (164 residues), 186.7 bits, E=1.4e-59

Best Hits

Swiss-Prot: 36% identical to CITX_SHIF8: Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K05964, holo-ACP synthase [EC: 2.7.7.61] (inferred from 89% identity to kpn:KPN_00056)

MetaCyc: 36% identical to apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (Escherichia coli K-12 substr. MG1655)
Citrate lyase holo-[acyl-carrier-protein] synthase. [EC: 2.7.7.61]

Predicted SEED Role

"Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.61)" (EC 2.7.7.61)

MetaCyc Pathways

• citrate lyase activation (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.61

Sequence Analysis Tools

See A0A285AYK1 at UniProt or InterPro

Protein Sequence (179 amino acids)

>BWI76_RS04560 holo-ACP synthase CitX (Klebsiella michiganensis M5al)
MSVDTLAREGVSMEALLAAKEQRAARQADWLAHYQRPLISLTLVTPGAVKDSIRYRNMMG
VALQACDQMLWKHRWQTLDRQVLWLPTGPEALWCVDHAASEIKAFCTDLEHTHPLGRLWD
IDVICPKNGLVGRQSMGENQRRCLLCDEPAHACARSRRHDTGEVVARVEQMIDAWFARD