Protein Info for BWI76_RS04540 in Klebsiella michiganensis M5al

Annotation: molecular chaperone DjlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details PF05099: TerB" amino acids 63 to 170 (108 residues), 33.1 bits, see alignment E=6.3e-12 PF00226: DnaJ" amino acids 213 to 271 (59 residues), 36 bits, see alignment E=6.2e-13

Best Hits

Swiss-Prot: 85% identical to DJLA_SALTY: Co-chaperone protein DjlA (djlA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_11045)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYD8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>BWI76_RS04540 molecular chaperone DjlA (Klebsiella michiganensis M5al)
MQYLGKIIGVAVALMMGGGFWGVVLGFLVGHMFDRARSRRLNVFANQQERQSLFFSTTFE
VMGHLTKSKGRVTEADIHVANLLMDRMSLHGEARTAAQHAFRVGKSDDYPLREKMRQLRS
VCFGRFDLIRMFLEIQLQAAFADGELHPNERDVLFVIADELGISRAQFEQFLRMMQGGAQ
FGGGSQQQSYGQRGGNAGWQQAQRGPTLEDACNVLGVKATDDAATVKRAYRKLMSEHHPD
KLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF