Protein Info for BWI76_RS04530 in Klebsiella michiganensis M5al

Annotation: peptidylprolyl isomerase SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF09312: SurA_N" amino acids 25 to 142 (118 residues), 165 bits, see alignment E=2.3e-52 PF13623: SurA_N_2" amino acids 25 to 103 (79 residues), 30.9 bits, see alignment E=7.2e-11 PF13624: SurA_N_3" amino acids 26 to 141 (116 residues), 51.8 bits, see alignment E=2.6e-17 PF13616: Rotamase_3" amino acids 166 to 272 (107 residues), 71.8 bits, see alignment E=2.1e-23 amino acids 282 to 383 (102 residues), 84.2 bits, see alignment E=3.1e-27 PF00639: Rotamase" amino acids 178 to 272 (95 residues), 78.1 bits, see alignment E=2.6e-25 amino acids 289 to 380 (92 residues), 88.9 bits, see alignment E=1.1e-28 PF13145: Rotamase_2" amino acids 192 to 276 (85 residues), 31.5 bits, see alignment E=8.4e-11 amino acids 301 to 384 (84 residues), 35.1 bits, see alignment E=6.4e-12

Best Hits

Swiss-Prot: 92% identical to SURA_SALPA: Chaperone SurA (surA) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 94% identity to kva:Kvar_4333)

MetaCyc: 90% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYD7 at UniProt or InterPro

Protein Sequence (428 amino acids)

>BWI76_RS04530 peptidylprolyl isomerase SurA (Klebsiella michiganensis M5al)
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQL
PDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTMDQMRSRLAY
DGINYSTYRNQIRKEMLISEVRNNEVRRRITVLPQEVETLAKQIGDQNDASTELNLSHIL
IPLPENPTSEQVAEAQEQANSVVEQARGGADFGKLAITYSADQQALKGGQMGWGRIQELP
GIFAQALSTAKKGDIVGPIRSGVGFHILKINDMRGGSQNISVTEVHARHILLKPSPIMND
DQARAKLEQIAADIKSGKTTFAKAAKEFSEDPGSANQGGDLGWATPDIFDPAFRDAILRL
NKGQTSAPVHSSFGWHLIELLDTRNVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRAS
AYVKVLSN