Protein Info for BWI76_RS04505 in Klebsiella michiganensis M5al

Annotation: dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 97% identical to DYR_KLEAE: Dihydrofolate reductase (folA) from Klebsiella aerogenes

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 94% identity to ecl:EcolC_3607)

MetaCyc: 94% identical to dihydrofolate reductase (Escherichia coli K-12 substr. MG1655)
Dihydrofolate reductase. [EC: 1.5.1.3]

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

superpathway of chorismate metabolism (54/59 steps found)
folate transformations III (E. coli) (9/9 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
folate transformations II (plants) (10/11 steps found)
superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
tetrahydrofolate biosynthesis I (3/3 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYD9 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BWI76_RS04505 dihydrofolate reductase (Klebsiella michiganensis M5al)
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSQPGTDDRVQWVKSVDEAIAACGDVEEMMVIGGGRVYEQFLPKAHKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR