Protein Info for BWI76_RS04420 in Klebsiella michiganensis M5al

Annotation: oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 TIGR01108: oxaloacetate decarboxylase alpha subunit" amino acids 5 to 584 (580 residues), 990.2 bits, see alignment E=1.5e-302 PF00682: HMGL-like" amino acids 123 to 266 (144 residues), 53.7 bits, see alignment E=3.1e-18 PF02436: PYC_OADA" amino acids 290 to 489 (200 residues), 196.1 bits, see alignment E=8.5e-62 PF00364: Biotin_lipoyl" amino acids 523 to 587 (65 residues), 65.8 bits, see alignment E=3.9e-22

Best Hits

Swiss-Prot: 94% identical to DCOA_SALTY: Oxaloacetate decarboxylase alpha chain (oadA1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01571, oxaloacetate decarboxylase, alpha subunit [EC: 4.1.1.3] (inferred from 96% identity to sea:SeAg_B0062)

Predicted SEED Role

"Oxaloacetate decarboxylase alpha chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>BWI76_RS04420 oxaloacetate decarboxylase (Klebsiella michiganensis M5al)
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYGSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALRAVRSHGAHAQGTLSYTTSPAHSLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAYELVSEIKKRYDVRLHLHAHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLESIAAYFREVRRKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGAAPVTCRPADLLKPELAALEEDVKRQAQEK
GIMLADNAIDDVLTVALFPQVGLKFLENRNNPAAFEPVPQAETAQPVAKAEKPAASGVYT
VEVEGQAFVVKVSDGGDISQLTAAVPATAPAAAAPAGAGAPVTAPLAGNIWKVTATEGQT
VAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA