Protein Info for BWI76_RS04390 in Klebsiella michiganensis M5al

Annotation: DUF805 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details PF05656: DUF805" amino acids 16 to 114 (99 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 61% identity to kpe:KPK_4724)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYF4 at UniProt or InterPro

Protein Sequence (120 amino acids)

>BWI76_RS04390 DUF805 domain-containing protein (Klebsiella michiganensis M5al)
MTNGQAYFNGWKKGLDFSGVASRQEFWSFLLINLLILALPLATWFLAMQHNSQYGVFIFF
AAPLSGLLSLPMIVPLLAVGCRRMHDIGRSGWWFALCLIIPWFLIVALWLCCLKPAASSR