Protein Info for BWI76_RS04380 in Klebsiella michiganensis M5al

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 6 to 15 (10 residues), see Phobius details transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 93 to 123 (31 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 314 to 345 (32 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 5 to 412 (408 residues), 209 bits, see alignment E=5.6e-66 PF03600: CitMHS" amino acids 15 to 364 (350 residues), 225.6 bits, see alignment E=1.4e-70 amino acids 333 to 415 (83 residues), 43.4 bits, see alignment E=3.8e-15 PF00939: Na_sulph_symp" amino acids 226 to 411 (186 residues), 71 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: None (inferred from 89% identity to eae:EAE_10890)

Predicted SEED Role

"Possible membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYC8 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BWI76_RS04380 anion transporter (Klebsiella michiganensis M5al)
MSPVTITLSLLVFSIVMFVWEKIPLAVTAMIVCITLVVTGVFDVQTAFSGFINQNVILFV
AMFVVGGALFETGVTDKIGGIVTRYARSEKQLIVIIMLVCGLLSGVLSNTGTAAVLIPVV
IGAAIKSGYARSRLLMPLAFASALGGNLSLIGSPGNLIAQSALEQVGQSFGFFEYAKLGI
PMLACGILYFVTIGYRILPGKNTLQKHGAESIRTVDCPTYKQVIALSVLIATVLGMIFEK
RIGLPIAIIGSIGALSLVMTRVITEKQAYQAIDSQTIFLFGGTLALAKALETTGAGAIMA
RSIIDLLGHQASPFLLLSAVLIISCILTNFMSNTATAALLMPIGLSIAHSMGADPRAVLM
AIVIGCSCAYATPVGTPANMMIFSAGGYKFVDYVKVGLPLILISVIVSFILLPIFFPFY