Protein Info for BWI76_RS04370 in Klebsiella michiganensis M5al

Annotation: FldA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF04303: PrpF" amino acids 1 to 350 (350 residues), 440.9 bits, see alignment E=1.8e-136

Best Hits

Swiss-Prot: 69% identical to YBHH_SHIFL: Putative isomerase YbhH (ybhH) from Shigella flexneri

KEGG orthology group: None (inferred from 81% identity to eae:EAE_10880)

MetaCyc: 51% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYH6 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BWI76_RS04370 FldA family protein (Klebsiella michiganensis M5al)
MKSIPCVLMRGGTSKGAFLLADDLPKDIQKRDDCLLAIMGSGHELEIDGIGGGSPQTSKV
AIISQSLSEEADIDYLFVQVIVNERRVDTTPNCGNMLCAVGGFAIEHGLVEAASPVTRVR
IRNVNTNTFIDADVQTPDGKVIYEGDSQIDGVPGRAAPVALTFLNAAGAKSGRLFPTGNR
MDVFDDVRVTCIDMAMPMVVIPAQSLGKTGYESASELDRDSGLLKSLESIRIQAGKAMGF
GDVTNMVIPKPVLISPALSGGSINVRYFMPHNCHKSLAITGAIGLASACIIPKTIANELT
KLSGDGIIKVEHPSGGIEVDLSQTTERPEDIRASVIRTARKILSGTVYIPE