Protein Info for BWI76_RS04305 in Klebsiella michiganensis M5al

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR02349: chaperone protein DnaJ" amino acids 5 to 348 (344 residues), 472.3 bits, see alignment E=6e-146 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 101.1 bits, see alignment E=6e-33 PF01556: DnaJ_C" amino acids 119 to 332 (214 residues), 181.1 bits, see alignment E=3e-57 PF00684: DnaJ_CXXCXGXG" amino acids 146 to 206 (61 residues), 63.5 bits, see alignment E=3.6e-21 PF27439: DnaJ_C_2" amino acids 338 to 375 (38 residues), 29.9 bits, see alignment 8.9e-11

Best Hits

Swiss-Prot: 97% identical to DNAJ_KLEP7: Chaperone protein DnaJ (dnaJ) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 95% identity to ecl:EcolC_3641)

MetaCyc: 94% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYA6 at UniProt or InterPro

Protein Sequence (378 amino acids)

>BWI76_RS04305 molecular chaperone DnaJ (Klebsiella michiganensis M5al)
MAKQDYYEILGVSRSAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDA
QKRAAYDQYGHAAFEQGGMGGGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRASRGADLR
YNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGSQPQTCPTCHGAGQVQMRQGFFA
VQQTCPHCQGRGTLIKDPCNKCHGHGRVEKTKTLSVKIPAGVDTGDRIRLAGEGEAGEHG
APAGDLYVQVQVKQHAIFEREGNNLYCEVPINFTMAALGGEIEVPTLDGRVNLKVPGETQ
TGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNDKQKQLLKDLQESFGGPTGEKNSP
RSKSFFDGVKKFFDDLTR