Protein Info for BWI76_RS04285 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 4 to 176 (173 residues), 143.5 bits, see alignment E=3.5e-46

Best Hits

Swiss-Prot: 85% identical to SATP_ECO57: Succinate-acetate/proton symporter SatP (satP) from Escherichia coli O157:H7

KEGG orthology group: K07034, (no description) (inferred from 96% identity to kpu:KP1_0831)

MetaCyc: 85% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"YaaH protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY94 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BWI76_RS04285 hypothetical protein (Klebsiella michiganensis M5al)
MGNTKLANPAPLGLMGFGMTTILLNLANSGLFAFDVAILAMGIFYGGIAQIFAGLLEFKK
GNTFGLTAFTSYGAFWLTLVAILLMPKMGLAEAPNAHFLGMYLGLWGIFTLFMFFGTLKA
ARMLQFVFLSLTVLFALLAIGHLADNEGIVKIAGWVGLVCGGSAIYLAMGEVLNEQFGRT
VLPIGEKH