Protein Info for BWI76_RS04280 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 400 to 417 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 17 to 229 (213 residues), 72.7 bits, see alignment E=3e-24 PF07690: MFS_1" amino acids 58 to 383 (326 residues), 99.1 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: None (inferred from 93% identity to kpu:KP1_0830)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYB2 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BWI76_RS04280 MFS transporter (Klebsiella michiganensis M5al)
MSHCTRPLNRQDYKTLTLAALGGALEFYDFIIFVFFAAVVGELFFPADIPEWLRQVQTFG
IFAAGYLARPLGGIIMAHFGDLVGRKKMFTLSILLMALPTLAIGLLPTYASVGIVAPLLL
LFMRILQGAAIGGEVPGAWVFVAEHVPEKRIGIACGTLTAGLTVGILLGSVVATLINTNL
TPQGIHEGGWRIPFLLGGAFGLVAMYLRRWLQETPVFLEMQQRKALAQELPVKAVALKHQ
KAVAVSMLLTWLLSAGVVVVILMSPVWLQKHYGFAPAITLQANSIATIMLCIGCLLAGLA
ADRFGASRTFIVGSVFLAAASWAFYHLSGASPQRLFLLYGTVGLCVGVVGAVPYVMVRAF
PAEVRFTGISFSYNVSYAIFGGLTPIAVTMLMGVSPMAPAWYVLALSFMGLGLGIWLRQG
LDEQVAAPKAELQRLP