Protein Info for BWI76_RS04225 in Klebsiella michiganensis M5al

Annotation: cell envelope integrity protein CreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 297 to 315 (19 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details PF06123: CreD" amino acids 6 to 427 (422 residues), 471.7 bits, see alignment E=1.1e-145

Best Hits

Swiss-Prot: 66% identical to CRED_ECOLI: Inner membrane protein CreD (creD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 76% identity to eae:EAE_10670)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY91 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BWI76_RS04225 cell envelope integrity protein CreD (Klebsiella michiganensis M5al)
MLKSPLFWKMSTLLGCILLLSIPLMIVRQLIVERADYRSEVIEALESSTSGSQKLVGPLI
AIPVTEVLTRIEDKKEVTYQRHWLHYWLPESLAIAGKQNVESRKIGIYEGQIWHNDLGIK
AQFDVSRLAELRKDNITLGKPVMVVGVSDARGIGTIIAPKINGEALPVEPGIGISGSGEG
IHMPMPLLTPQQKTLDVEFTLNLNGTGSFSVAPLGRNSQLQLTSNWAHPGFLGDFLPVSR
EVSPSGYSARWQSSWFANNMARFFMDDREIEWRQLPAFNVNVTTPADRYQLTDRATKYAI
LLISLTFMAFFVFESLTQCRLHPMQYLLVGLSLVMFYLILLALSEHIGFTPSWIVASLIG
ALINGVYLNAVLKGWLNSFLFVCALLLLDGVMWMLLRSEDSALLLGTGVLLLALSALMFL
TRRVDWYTLSLPKPKERQPEGGDDDDKLRIWK