Protein Info for BWI76_RS04160 in Klebsiella michiganensis M5al

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF18429: DUF5609" amino acids 37 to 100 (64 residues), 62 bits, see alignment E=7.6e-21 TIGR00338: phosphoserine phosphatase SerB" amino acids 98 to 316 (219 residues), 310.1 bits, see alignment E=8.1e-97 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 113 to 284 (172 residues), 94.4 bits, see alignment E=7.9e-31 PF00702: Hydrolase" amino acids 114 to 285 (172 residues), 83 bits, see alignment E=7.5e-27 PF12710: HAD" amino acids 115 to 281 (167 residues), 70.5 bits, see alignment E=5.4e-23 PF08282: Hydrolase_3" amino acids 249 to 313 (65 residues), 50.5 bits, see alignment E=4.8e-17

Best Hits

Swiss-Prot: 88% identical to SERB_ECO57: Phosphoserine phosphatase (serB) from Escherichia coli O157:H7

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 96% identity to kpu:KP1_0804)

MetaCyc: 88% identical to phosphoserine phosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoserine phosphatase. [EC: 3.1.3.3]

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYC4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>BWI76_RS04160 phosphoserine phosphatase (Klebsiella michiganensis M5al)
MPNSLTWCDLPEDVSLWPGLPLSLSGDEVMPLDYHAGRSGWLLYGRGLNKHRLTEWQREL
GAALVIVASWAVDDYQVMRLAGSLTLRATRLAHEAGFDVAPLGKIPHLRTPGLLVMDMDS
TAIQIECIDEIAKLAGTGELVSEVTERAMRGELDFTASLRQRVATLKDADASILLQVRES
LPLMPGLTQLVLKLETLGWKVAIASGGFTFFAEYLRDKLHLDAVFANELEIRDGKLTGNV
IGDIVDAKYKANTLRKLAEKYEIPPAQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNELA
EVTIRHADLMGVFCILSGSMNQK