Protein Info for BWI76_RS04125 in Klebsiella michiganensis M5al

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 261 to 288 (28 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 325 to 325 (1 residues), see Phobius details amino acids 327 to 337 (11 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 5 to 422 (418 residues), 501.8 bits, see alignment E=7.4e-155 PF01773: Nucleos_tra2_N" amino acids 8 to 81 (74 residues), 82.7 bits, see alignment E=3.3e-27 PF07670: Gate" amino acids 98 to 196 (99 residues), 71.3 bits, see alignment E=1.3e-23 PF07662: Nucleos_tra2_C" amino acids 201 to 420 (220 residues), 276.8 bits, see alignment E=1.8e-86

Best Hits

Swiss-Prot: 64% identical to Y519_HAEIN: Uncharacterized transporter HI_0519 (HI_0519) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 94% identity to kpn:KPN_04836)

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY76 at UniProt or InterPro

Protein Sequence (425 amino acids)

>BWI76_RS04125 NupC/NupG family nucleoside CNT transporter (Klebsiella michiganensis M5al)
MQIIMGLIGMVVLLAIAVLLSSNRKAINLRTVLGAWIIQVGIGALILYVPAGRTALLAMS
NGVANVIAYGNEGIGFIFGGLVSDKMFEVFGGGGFVFALRVLPVIVFFSSLIAVLYYLGI
MQFVIRILGGALRAVLKTSRTESLSATANIFVGQTEAPLVVRPYIATMTRSELFAVMCGG
LASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKIIVPETEQPRDNPAMEKNDADP
QAPANVLDAAASGAASGMQLALNVGAMLLAFIALIALVNGILSGVGGWFNHPDLSLQMIL
GWVFSPLAWVIGVPWNEATVAGSFIGQKLIINEFVAYMNFGEYLKADTEVAAAGLQVIST
HTKAIISFALCGFANLSSIAILIGGLGGMAPNRRQEIAQLGMRAVAAGTLSNLMSATIAG
VFLAL