Protein Info for BWI76_RS04105 in Klebsiella michiganensis M5al

Annotation: molecular chaperone OsmY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04972: BON" amino acids 57 to 124 (68 residues), 69.7 bits, see alignment E=1e-23 amino acids 137 to 203 (67 residues), 68.5 bits, see alignment E=2.4e-23

Best Hits

Swiss-Prot: 67% identical to OSMY_ECOLI: Osmotically-inducible protein Y (osmY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 77% identity to eae:EAE_10560)

Predicted SEED Role

"Osmotically inducible protein OsmY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYA5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>BWI76_RS04105 molecular chaperone OsmY (Klebsiella michiganensis M5al)
MTRLKSGKTLLALFLGSAIISASAYAENSTVDSAKSAASNAGQAVDNSMNKVGNFMDDST
ITARVKAALIDHKDIRSTDISVKTEDKVVTLSGTVDSSEQHQQALSVAKAVEGVSSVNDK
LSVQNEKSASLKGYAGDTAVTSEIKAKLLADDIVPSRNVKVETTDGVVHLSGTVASSKQS
ERAEGIAKAVSGVKSVKNDLSVK