Protein Info for BWI76_RS04055 in Klebsiella michiganensis M5al

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 186 to 345 (160 residues), 156.8 bits, see alignment E=2.1e-50 PF00990: GGDEF" amino acids 190 to 343 (154 residues), 156.4 bits, see alignment E=2.9e-50

Best Hits

KEGG orthology group: None (inferred from 82% identity to kpe:KPK_4792)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY57 at UniProt or InterPro

Protein Sequence (348 amino acids)

>BWI76_RS04055 GGDEF domain-containing protein (Klebsiella michiganensis M5al)
MTAQSWRSHYEQKYQYSLRLFLLLNLVSSFLSLVSPLFTVITFTLPCFLIVACSTVLLLW
HCKFAQHKINIPVISLIFGLLWAWHVALKAMMMGPPHFNYLVIALLSVLFIGTIAFSSNI
IGFTLHSLPTYLTCLILGGGEQWLRMSWCFLLPIAGITLQSLIQKRSDIFTQGLMDKLLK
ERNTLNDLSMLDPLTGLYNRRGLQNRLDTVLSLDSAGHYVLLLDIDHFKAYNDHYGHMMG
DQALIQVSAAIRNAVRSRDIVARFGGEEFMVLLTSSSAENALQAAERIRQRVYDLKIPHM
FNESVATNVTISIGMTPLVDADIDSALKRADNALYEAKNMGRNIILAS