Protein Info for BWI76_RS04020 in Klebsiella michiganensis M5al

Annotation: 4-hydroxybenzoate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02360: 4-hydroxybenzoate 3-monooxygenase
  • amino acids 1 to 390 (390 residues), 641.5 bits, E=2.2e-197
• PF01494: FAD_binding_3
  • amino acids 2 to 342 (341 residues), 306.3 bits, E=1.6e-95

Best Hits

Swiss-Prot: 69% identical to PHHY_PSEAE: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 88% identity to kpn:KPN_04815)

MetaCyc: 75% identical to p-hydroxybenzoate hydroxylase (Pseudomonas putida)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-hydroxymandelate degradation (3/6 steps found)
• 4-chlorobenzoate degradation (1/4 steps found)
• 4-methylphenol degradation to protocatechuate (1/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• 4-coumarate degradation (aerobic) (1/5 steps found)
• bisphenol A degradation (1/5 steps found)
• spongiadioxin C biosynthesis (2/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (2/8 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

See A0A285AY79 at UniProt or InterPro

Protein Sequence (394 amino acids)

>BWI76_RS04020 4-hydroxybenzoate 3-monooxygenase (Klebsiella michiganensis M5al)
MKTQVAIIGAGPSGLLLGQLLHHAGIQTVILERQTPEYVLGRIRAGILESGTVELLREAG
AARRMDAEGLIHHGVEFLFEGKRVPVALTELTEGKSVMVYGQTEVTRDLMAARAESGAPT
IYGVSDVTINDAKSDRPSVSFACNGENHRLECDFIAGCDGFHGVSRQSIPAGVLKEYESV
WPFGWLGLLADTPPVNPELIYAHHERGFVLCSQRSLTRSRYYLQVPLSEKVEAWSDERFW
NELKRRLPDELSSKLVTGHSLEKSIAPLRSYVVEPMQYGKLFLLGDAAHIVPPTGAKGLN
LAASDVNYLWRILREYYHHGRVDLLASYSRLALDRVWKGERFSWFMTRLLHDFPQQSEFD
RKMQAADRRYYLQSRAGLTTIAENYVGLPMERVV