Protein Info for BWI76_RS04015 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details PF06738: ThrE" amino acids 13 to 251 (239 residues), 229.3 bits, see alignment E=2.4e-72

Best Hits

Swiss-Prot: 87% identical to YJJP_ECOLI: Inner membrane protein YjjP (yjjP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_10485)

Predicted SEED Role

"FIG023911: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY43 at UniProt or InterPro

Protein Sequence (258 amino acids)

>BWI76_RS04015 membrane protein (Klebsiella michiganensis M5al)
MQADRATQRAITRLCIQCGLFLLQHGAESALVEELSTRLGLALGMDSVESAISSNAIVLT
TIKDGECLTSTRKNTDRGINMHVVTEVQHIVIMAEHKLLDYKDVEKRFAQIKPLRYPRWL
LVLMVGLSCACFCKLNNGGWDGALVTFCASTIAMYIRQVLTHRSMHPQINFCLTAFVATT
ISGLMLRLPAFASTPTIAMAASVLLLVPGFPLINAVADMFKGHINTGLARWAIASLLTLA
TCIGVVMAMTMWGLRGWA