Protein Info for BWI76_RS03985 in Klebsiella michiganensis M5al

Annotation: ISNCY family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF04754: Transposase_31" amino acids 8 to 209 (202 residues), 288.9 bits, see alignment E=2e-90 TIGR01784: conserved hypothetical protein" amino acids 9 to 312 (304 residues), 184.8 bits, see alignment E=1.5e-58 PF27070: HTH_Rpn_C" amino acids 280 to 315 (36 residues), 53.4 bits, see alignment 1.3e-18

Best Hits

Swiss-Prot: 54% identical to YTL2_SALTY: Recombination-promoting nuclease pSLT051 (PSLT051) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 88% identity to kpu:KP1_0766)

MetaCyc: 62% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"Transposase KP1_0766"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY45 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BWI76_RS03985 ISNCY family transposase (Klebsiella michiganensis M5al)
MKKRMTSTPHDAVFKRFLRHPETANDFLTLYLPEEIRQQCDFATLRLESASFVDEDLRAW
YSDVLWSVQTTSGPGYVYVVIEHQSSPDNHMAFRLMRYAIAAMQRHLDAGHKELPLVVPM
LFYHGATSPYPFSLNWLDEFADPQMAKTLYGRPFPLIDVTAMPDDEIVQHRRVALLELMQ
KHIRQRDLSGITESLATLVMLGYTNRRQLRVLFHYMLQYGNTADPSVFLRRLARRLPQYE
ERLMSIAQKLKQEGWQEGKQEGMREGIQEGRQEGLQEGSRREALRIASSMLQDGLDKETV
QRITGLSADELKPLHC