Protein Info for BWI76_RS03970 in Klebsiella michiganensis M5al

Annotation: PTS mannose/fructose/sorbose family transporter subunit IID

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 45 to 62 (18 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF03613: EIID-AGA" amino acids 21 to 283 (263 residues), 357.3 bits, see alignment E=2.2e-111

Best Hits

KEGG orthology group: K02796, PTS system, mannose-specific IID component (inferred from 98% identity to kva:Kvar_4442)

MetaCyc: 86% identical to fructoselysine/glucoselysine PTS enzyme IID component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

"PTS system, mannose-specific IID component"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY70 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS03970 PTS mannose/fructose/sorbose family transporter subunit IID (Klebsiella michiganensis M5al)
MTTKMISEETLRPQEQEETRITPRDLRRVFWRSFQMEFSWNYERQMNLAFVYALIPVLKK
LYPRKEELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQQKNMDANAIDNVKASLMG
PLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILVRWFFTRWGYVLG
TGVLQRIQKSGMMESLTYGASIIGLMVVGAMTASMIDITIPVSFGAGEAKTQVQDIINDI
LPCMLPLLSFGIVYWLLGRKVKPLSIIGGMALVGILGSWIGLF