Protein Info for BWI76_RS03965 in Klebsiella michiganensis M5al

Annotation: PTS sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 62 to 62 (1 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 205 to 235 (31 residues), see Phobius details PF03609: EII-Sor" amino acids 2 to 232 (231 residues), 241.1 bits, see alignment E=5.5e-76

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 98% identity to kpu:KP1_0762)

MetaCyc: 83% identical to fructoselysine/glucoselysine PTS enzyme IIC component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

"PTS system, mannose-specific IIC component"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY32 at UniProt or InterPro

Protein Sequence (259 amino acids)

>BWI76_RS03965 PTS sugar transporter (Klebsiella michiganensis M5al)
MVEALLLGLVAFIAQSEYALGTSLISRPIVTGLLTGLVLGDVQTGVIMGATLELAFIGSF
SVGASIPPDVVTGGILGVAFAITSGAGTETALLLGLPIATLTLILKNVYLGMFIPMLSQK
ADGYAERADTRGIERMHLIAGFGLSLMLATVVTVSFLVGSNAVKSLLDTIPEFIKHGLSV
ATGIIPALGFAMLARLLINKKVAPYFFLGFVLMAYLKIPVTGIAILGAIVAVVMVNVTAL
SSPRTTTEQGVSDDDEDDF