Protein Info for BWI76_RS03930 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 108 to 135 (28 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details amino acids 356 to 383 (28 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details PF07690: MFS_1" amino acids 47 to 408 (362 residues), 200.1 bits, see alignment E=2.6e-63

Best Hits

Swiss-Prot: 90% identical to LGOT_ECOLI: Probable L-galactonate transporter (lgoT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to kpe:KPK_4817)

MetaCyc: 90% identical to galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-227

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY35 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BWI76_RS03930 MFS transporter (Klebsiella michiganensis M5al)
MEQQNITIDPQTTFKKGKAETISVPLDNTLTRSTRIKKIQTTAMILLFLAAVINYLDRSS
LSVANLTIREELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGPRIMLGLGMFFWSLF
QAVSGMVHSFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKERGRPMGFFNAASTIGVA
ISPPILAAMMLMMGWRGMFITIGLLGIFVAIGWYMLYRNREDIALTADEQAYLNAGSVNV
RRDPLSFAEWRSLFKNKTMWGMMLGFSGINYTAWLYLAWLPGYLQTAYNLDLKSTGFMAA
IPFLFGAAGMLINGYVTDWLVKGGMAPIKSRKICIIAGMFCSAAFTLVVPQATTSIVAVL
LIGMALFCIHFAGTSCWGLIHVAVASRMTASVGSIQNFASFICASFAPVVTGFIVDTTHS
FQLALIICGCVTALGALAYIFLVRQPISDPRNG