Protein Info for BWI76_RS03900 in Klebsiella michiganensis M5al

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 434 to 458 (25 residues), see Phobius details PF00474: SSF" amino acids 34 to 419 (386 residues), 145 bits, see alignment E=1.6e-46

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 89% identity to ecm:EcSMS35_4898)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY81 at UniProt or InterPro

Protein Sequence (495 amino acids)

>BWI76_RS03900 Na+/proline symporter (Klebsiella michiganensis M5al)
MNSHIFLVGFIIYALAMIWLGWYVSRNQKSGEDFLLGGRSLPLFLTLGSTVATMVGTGSS
MGAVGFGYSNGWAGMLYGVGGAIGILLVAWLFAPVRKLRFMTMSEELSYYTGGSHLIKNI
VGIMIFIASIGWLGAHILGGSMYLSWATGINLTLAKIIIALAFAIYVIIGGYSAVVWTDT
IQALILFFGFILMAILAVVHVGGWDAIVQAMDPKAMSLFAVDKLGVMPALSLAMVIGVGV
LATPSYRQRIYSGKDVSSVRRSFVYTGVLYLFFSVLPAIIGMAAWTMNPHLENSNYAFLF
ATSFLPAMLGLVVLIAGLSATMSSASSDAIAAVAIMMRDVYTLVTGKMPPADKAITLSRW
MLAFVIGLAMIFALTSNDIISYITKMISMLMSGLFVCSILGRFWLRFNWQGALTALLSGM
LVSIVVLIKADWLAYWGNPCIPSVVGSFVSAVFVTLMTPASKISRQQALEMITLEREGQA
APAKTAVAQASGEAQ