Protein Info for BWI76_RS03850 in Klebsiella michiganensis M5al

Annotation: 2-oxo-hepta-3-ene-1,7-dioic acid hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR02312: 2-oxo-hepta-3-ene-1,7-dioic acid hydratase" amino acids 1 to 267 (267 residues), 462.5 bits, see alignment E=2.3e-143 PF01557: FAA_hydrolase" amino acids 92 to 266 (175 residues), 32.1 bits, see alignment E=4.8e-12

Best Hits

Swiss-Prot: 96% identical to HPCG_ECOLX: 2-oxo-hept-4-ene-1,7-dioate hydratase (hpcG) from Escherichia coli

KEGG orthology group: K02509, 2-oxo-hept-3-ene-1,7-dioate hydratase [EC: 4.2.1.-] (inferred from 97% identity to seg:SG0994)

MetaCyc: 96% identical to 2-hydroxyhepta-2,4-dienedioate hydratase monomer (Escherichia coli C)

Predicted SEED Role

"2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Benzoate transport and degradation cluster or Central meta-cleavage pathway of aromatic compound degradation (EC 4.2.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-, 4.2.1.-

Use Curated BLAST to search for 4.2.-.- or 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY65 at UniProt or InterPro

Protein Sequence (267 amino acids)

>BWI76_RS03850 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (Klebsiella michiganensis M5al)
MLDKHTHTLIAQRLNQAEKQREQIRAISLDHPTITIEDAYAVQREWVNMKIAEGRVLKGH
KIGLTSKAMQASSQISEPDYGALLDDMFFHDGGDIPTDRFIVPRIEVELAFVLAKPLRGP
NCTLFDVYNATDYVIPALELIDARCHNIDPETQRPRKVFDTISDNAANAGVILGGRPIKP
DELDLRWISALLYRNGVIEETGVAAGVLNHPANGVAWLANKLAPYDVQLEAGQIILGGSF
TRPVPARKGDTFHVDYGNMGAISCRFV