Protein Info for BWI76_RS03785 in Klebsiella michiganensis M5al

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF02311: AraC_binding" amino acids 28 to 139 (112 residues), 79.1 bits, see alignment E=5.3e-26 PF07883: Cupin_2" amino acids 33 to 77 (45 residues), 36.5 bits, see alignment 6.2e-13 PF12833: HTH_18" amino acids 186 to 264 (79 residues), 66.3 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: None (inferred from 67% identity to ses:SARI_03051)

Predicted SEED Role

"L-rhamnose operon regulatory protein RhaS" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY78 at UniProt or InterPro

Protein Sequence (271 amino acids)

>BWI76_RS03785 AraC family transcriptional regulator (Klebsiella michiganensis M5al)
MSHTRNIQQTFWRDEQLPWLELRSTWNSRQAYKRHRHPQLSIGAIIEGETRCLCNGQEYL
LRPGDLIIIPAQAPHSCNPRDGQPRSYHMLYLELSWCWRQLAGDGHHERLIASQPVIRDA
ELFARYLQIVELMSQQNTAALPESVARLLRGLPLRPLAPAALSQTSARLFSRLATNLQAP
PTLDSLAEEFALRKETLIRAFKHDTGLTPASFINIARIEFAKSRLRAGDTIADVGYQAGF
ADQSHFHKTFVSYTAATPRQYAQRRSITDNN