Protein Info for BWI76_RS03725 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 35 to 64 (30 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details PF07670: Gate" amino acids 29 to 124 (96 residues), 35.8 bits, see alignment E=4.8e-13

Best Hits

Swiss-Prot: 47% identical to YJIG_ECOLI: Inner membrane protein YjiG (yjiG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to kpe:KPK_4861)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXY6 at UniProt or InterPro

Protein Sequence (155 amino acids)

>BWI76_RS03725 membrane protein (Klebsiella michiganensis M5al)
MNNSAKVGSNPFDIFVIGARKGFNIAINNLMPNVLMAYVIAEMLNLLGVMQIIGHVCAPL
MGLFGLPGEAITVLLTSWLSASAGTGVAVSLLSKGTLNVADITILIPAIFLMGSQLQYMG
RLLGVADVPKKYWPLLMAVSIINAVIAMLVMRVIA