Protein Info for BWI76_RS03640 in Klebsiella michiganensis M5al

Annotation: amino acid permease-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details PF13520: AA_permease_2" amino acids 23 to 408 (386 residues), 106 bits, see alignment E=2.2e-34 PF00324: AA_permease" amino acids 48 to 389 (342 residues), 93.6 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 95% identity to eae:EAE_10160)

Predicted SEED Role

"Putrescine importer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXX4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BWI76_RS03640 amino acid permease-associated protein (Klebsiella michiganensis M5al)
MSVEQFGYKQELHRALTFRDLLVYGMIFMVPIAPFGVFGYVWDGAQGMVALAYLIGMVAM
FFTAMSYWSMSRAFPVSGSVYAYAQRGIHPIVGFFAGWLILLDYILVPSLLYIVSAAALA
PMLPGVPGWLWIVGFIAINSLINLRGITFTARANNTILIAEIVVLSVFVVLGLIALYSGA
GAGHLTLDPLYNADKFSLPLVMGAVSIAVLSFLGFDGISTLSEETKDGVDTVGKASLGAL
MLVGSLFILQTWIAADLAQGMTFSSLDTAFYDTANLAGGGWLKYVTMWSTVISWGIANAL
VAQAAVSRILFAMARDKQLPQLLAKVHPRLKTPYVSTLFVALISLASGLWFYGDIDNLSR
LVNFGALMGFLVLHIAVINYYIIRQKSRNLVVHLLFPVVGLCIIGFVIYEMDAQAKVLGL
SWLAVGVVYYLLMRLVLKRNVELKLEG