Protein Info for BWI76_RS03615 in Klebsiella michiganensis M5al

Annotation: putative transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 146 to 169 (24 residues), see Phobius details PF00486: Trans_reg_C" amino acids 29 to 94 (66 residues), 30.8 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 80% identity to eae:EAE_10110)

Predicted SEED Role

"FIG00733024: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXX2 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS03615 putative transcriptional regulatory protein (Klebsiella michiganensis M5al)
MRYNIHGRLIYDAMDGTLTLPGSDEADSQLSITANTLLWFFLRHTEVVSRDEVLKKVWDD
NGLTSSNSNLNQYLSMLRKTFRHYDIDNIIVTVSRGLLQLNPDLTIEMLDASPEPEPPLA
AEAEPDPAAVPEEKKTVSSRHARGTCWYLAGGCLLTIALLLVVCSFLGGNTSHPITLTQM
RHSQCELLASDEMLRSVAGTAYGKNFDVVRQRLKLECKPGERFVFFYGDRLETNGLGRVF
LAHCAMHEDNPFSYCDNYFYYSWKPQ