Protein Info for BWI76_RS03590 in Klebsiella michiganensis M5al
Annotation: acetaldehyde dehydrogenase (acetylating)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 92% identity to eae:EAE_10085)Predicted SEED Role
"Acetaldehyde dehydrogenase, ethanolamine utilization cluster (EC 1.2.1.10)" (EC 1.2.1.10)
MetaCyc Pathways
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- superpathway of L-threonine metabolism (18/18 steps found)
- mixed acid fermentation (16/16 steps found)
- heterolactic fermentation (16/18 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
- superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
- superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
- ethanolamine utilization (5/5 steps found)
- mandelate degradation to acetyl-CoA (14/18 steps found)
- 2-deoxy-α-D-ribose 1-phosphate degradation (3/3 steps found)
- 2-deoxy-D-ribose degradation I (3/3 steps found)
- 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
- pyruvate fermentation to ethanol I (3/3 steps found)
- pyruvate fermentation to ethanol III (3/3 steps found)
- L-threonine degradation IV (2/2 steps found)
- ethanol degradation I (2/2 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- catechol degradation I (meta-cleavage pathway) (4/5 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
- catechol degradation II (meta-cleavage pathway) (4/7 steps found)
- toluene degradation I (aerobic) (via o-cresol) (4/7 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
- 2-aminoethylphosphonate degradation I (1/3 steps found)
- sulfoacetaldehyde degradation IV (1/3 steps found)
- meta cleavage pathway of aromatic compounds (6/10 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
- toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
- p-cumate degradation (3/8 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
- triethylamine degradation (1/6 steps found)
- naphthalene degradation to acetyl-CoA (5/12 steps found)
- L-tryptophan degradation IX (4/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
- p-cymene degradation (3/11 steps found)
- superpathway of aerobic toluene degradation (15/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.10
Use Curated BLAST to search for 1.2.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (533 amino acids)
>BWI76_RS03590 acetaldehyde dehydrogenase (acetylating) (Klebsiella michiganensis M5al) MIELDNDLQSRQNARELVRNAKKAQAILATFSQQQIDAIVKNVAQEAAHHAEALAKMAAE ETGFGNWQDKVLKNRFASLRVYDAIKDMKTVGIIHDDQVQKVMDVGVPLGVICALVPSTN PTSTVIYKTLIALKAGNAIIFSPHPGARQCSWKAIEIVKRAAEAAGAPAGSVDAISQLTL EATSELMHSKDVSLILATGGEGMVRAAYASGTPTISGGPGNGPAFIERSADIPHAVKDII TSKTFDNGVICASEQSIIVERCIYDEVHRELEAQGAYFMNESEAAKMAALLLRPNGTINP KVVGKTALYLSQMAGFCVPASTRVLIAEQTTVSHTNPYSREKLCPVLGLYVEEDWKAACQ RVVELLTNEGLGHTLVIHTRNQDVIRQFCLEKPVNRILINTPAALGGIGATTNITPALTL GCGAVGGGSSSDNVGPMNLLNIRKVGYGVRSIDELRAPGSRPEPQPIIVSPAAGPNRSIF DDERFNAPAAAATAAHPASADDRFATAAVGAESEINEQNVERVIRQVLERLGK