Protein Info for BWI76_RS03570 in Klebsiella michiganensis M5al

Annotation: choline TMA-lyase-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR04395: choline TMA-lyase-activating enzyme" amino acids 6 to 313 (308 residues), 415.5 bits, see alignment E=1.4e-128 TIGR02494: glycyl-radical enzyme activating protein" amino acids 9 to 304 (296 residues), 367.8 bits, see alignment E=3.9e-114 PF13353: Fer4_12" amino acids 19 to 55 (37 residues), 22.3 bits, see alignment 5.9e-08 PF04055: Radical_SAM" amino acids 27 to 238 (212 residues), 50.8 bits, see alignment E=9.1e-17 PF12797: Fer4_2" amino acids 51 to 70 (20 residues), 26.9 bits, see alignment (E = 1.3e-09) PF00037: Fer4" amino acids 53 to 71 (19 residues), 25.8 bits, see alignment (E = 2.7e-09) PF12837: Fer4_6" amino acids 53 to 72 (20 residues), 28.6 bits, see alignment (E = 4e-10) PF13237: Fer4_10" amino acids 53 to 102 (50 residues), 33.2 bits, see alignment 1.6e-11 PF12838: Fer4_7" amino acids 57 to 106 (50 residues), 34.5 bits, see alignment 9.1e-12 PF13187: Fer4_9" amino acids 57 to 106 (50 residues), 34.2 bits, see alignment 8.5e-12

Best Hits

Swiss-Prot: 46% identical to CUTD_DESAG: Choline trimethylamine-lyase activating enzyme (cutD) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 94% identity to kva:Kvar_4521)

MetaCyc: 46% identical to choline trimethylamine-lyase activating enzyme (Oleidesulfovibrio alaskensis G20)
RXN-16470

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXV8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>BWI76_RS03570 choline TMA-lyase-activating enzyme (Klebsiella michiganensis M5al)
MNKELTGRIFNIQKYSIYDGDGIRTLVFFKGCNIRCPWCANPEGLASQFQVMFSQDKCIN
CGDCVNVCPAGIHYRAEENGEMKHFVNRNKDCIGCRKCEEICTQNALDIMGKDVTVSELM
DIIMQDYDFYISSGGGVTIGGGEMSLQTDFAVALFSECKKMMLNTAVETQGTTPLANYQK
LAPVTDTFLFDIKQINSEHHKALFGIGNEGIRRNLEWLVDSGANVIIRMPLVRGYNDSFD
AITGAIDYVQKLAKRGNIRRIDMLPYHQLGRKKYERLDMPYPITRDPTYSAAELDRLETF
FTQFDFDIRLVRH