Protein Info for BWI76_RS03570 in Klebsiella michiganensis M5al

Annotation: choline TMA-lyase-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04395: choline TMA-lyase-activating enzyme
  • amino acids 6 to 313 (308 residues), 415.5 bits, E=1.4e-128
• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 9 to 304 (296 residues), 367.8 bits, E=3.9e-114
• PF12797: Fer4_2
  • amino acids 51 to 70 (20 residues), 26.5 bits, see alignment (E = 1.7e-09)
• PF00037: Fer4
  • amino acids 53 to 71 (19 residues), 25.8 bits, see alignment (E = 2.7e-09)
• PF12837: Fer4_6
  • amino acids 53 to 72 (20 residues), 29.1 bits, see alignment (E = 2.8e-10)
• PF13237: Fer4_10
  • amino acids 53 to 102 (50 residues), 34.1 bits, 9.2e-12
• PF13187: Fer4_9
  • amino acids 57 to 106 (50 residues), 34.5 bits, 7e-12
• PF12838: Fer4_7
  • amino acids 57 to 106 (50 residues), 35.3 bits, 5.3e-12
• PF04055: Radical_SAM
  • amino acids 111 to 238 (128 residues), 44.1 bits, E=1e-14

Best Hits

Swiss-Prot: 46% identical to CUTD_DESAG: Choline trimethylamine-lyase activating enzyme (cutD) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 94% identity to kva:Kvar_4521)

MetaCyc: 46% identical to choline trimethylamine-lyase activating enzyme (Oleidesulfovibrio alaskensis G20)
RXN-16470

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See A0A285AXV8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>BWI76_RS03570 choline TMA-lyase-activating enzyme (Klebsiella michiganensis M5al)
MNKELTGRIFNIQKYSIYDGDGIRTLVFFKGCNIRCPWCANPEGLASQFQVMFSQDKCIN
CGDCVNVCPAGIHYRAEENGEMKHFVNRNKDCIGCRKCEEICTQNALDIMGKDVTVSELM
DIIMQDYDFYISSGGGVTIGGGEMSLQTDFAVALFSECKKMMLNTAVETQGTTPLANYQK
LAPVTDTFLFDIKQINSEHHKALFGIGNEGIRRNLEWLVDSGANVIIRMPLVRGYNDSFD
AITGAIDYVQKLAKRGNIRRIDMLPYHQLGRKKYERLDMPYPITRDPTYSAAELDRLETF
FTQFDFDIRLVRH