Protein Info for BWI76_RS03560 in Klebsiella michiganensis M5al

Annotation: propanediol utilization phosphotransacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF06130: PTAC" amino acids 22 to 197 (176 residues), 257.1 bits, see alignment E=8.4e-81

Best Hits

Swiss-Prot: 56% identical to PDUL_THEMA: Phosphate propanoyltransferase (pduL) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 94% identity to kpe:KPK_4886)

MetaCyc: 55% identical to phosphate propanoyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Phosphate acetyltransferase. [EC: 2.3.1.8]; PTAALT-RXN [EC: 2.3.1.8, 2.3.1.222]

Predicted SEED Role

"Ethanolamine utilization protein similar to PduL" in subsystem Ethanolamine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.222 or 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXV0 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BWI76_RS03560 propanediol utilization phosphotransacylase (Klebsiella michiganensis M5al)
MIDTLLHEKIAARLSHVAPAIPVGISNRHVHLAQQDVEALFGKGYVLTPFKPLRQPGQFA
AQECVTVVGPKGSLTQVRVLGPTRPVSQLEISRADCFTLGIKAPVRESGQLENAGSALLI
GPAGHVELRSQVICAWRHIHMSPQDARHLNVANGQKVSVRSDGERQLTFDEVVVRVREDF
ALEFHIDTEEANAAGLKNGAQVTLIG